CDS

Accession Number TCMCG034C31128
gbkey CDS
Protein Id XP_028945425.1
Location join(22363710..22363915,22364074..22364152,22364244..22364333,22365391..22365408)
Gene LOC103450241
GeneID 103450241
Organism Malus domestica

Protein

Length 130aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA534520
db_source XM_029089592.1
Definition transcription factor MYB58-like isoform X2 [Malus domestica]

EGGNOG-MAPPER Annotation

COG_category S
Description E3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule nucleation. Required for normal cell cycle progression from G2 to mitosis. Required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. Involved in transcriptional regulation of P21 in response to DNA damage. Required for FANCD2 targeting to sites of DNA damage. May function as a transcriptional regulator
KEGG_TC -
KEGG_Module M00295        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko01009        [VIEW IN KEGG]
ko03032        [VIEW IN KEGG]
ko03036        [VIEW IN KEGG]
ko03400        [VIEW IN KEGG]
ko04121        [VIEW IN KEGG]
KEGG_ko ko:K10605        [VIEW IN KEGG]
ko:K11136        [VIEW IN KEGG]
EC 2.3.2.27        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
3.6.4.12        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko01524        [VIEW IN KEGG]
ko03440        [VIEW IN KEGG]
ko03460        [VIEW IN KEGG]
ko04120        [VIEW IN KEGG]
ko04151        [VIEW IN KEGG]
ko05206        [VIEW IN KEGG]
ko05224        [VIEW IN KEGG]
map01524        [VIEW IN KEGG]
map03440        [VIEW IN KEGG]
map03460        [VIEW IN KEGG]
map04120        [VIEW IN KEGG]
map04151        [VIEW IN KEGG]
map05206        [VIEW IN KEGG]
map05224        [VIEW IN KEGG]
GOs GO:0000003        [VIEW IN EMBL-EBI]
GO:0000151        [VIEW IN EMBL-EBI]
GO:0000152        [VIEW IN EMBL-EBI]
GO:0000280        [VIEW IN EMBL-EBI]
GO:0000724        [VIEW IN EMBL-EBI]
GO:0000725        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0004842        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005515        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006259        [VIEW IN EMBL-EBI]
GO:0006281        [VIEW IN EMBL-EBI]
GO:0006289        [VIEW IN EMBL-EBI]
GO:0006302        [VIEW IN EMBL-EBI]
GO:0006310        [VIEW IN EMBL-EBI]
GO:0006464        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006915        [VIEW IN EMBL-EBI]
GO:0006950        [VIEW IN EMBL-EBI]
GO:0006974        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0007049        [VIEW IN EMBL-EBI]
GO:0007059        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008219        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0012501        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016567        [VIEW IN EMBL-EBI]
GO:0016740        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0019787        [VIEW IN EMBL-EBI]
GO:0022402        [VIEW IN EMBL-EBI]
GO:0022414        [VIEW IN EMBL-EBI]
GO:0031436        [VIEW IN EMBL-EBI]
GO:0032446        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0033554        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0036211        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043412        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0045132        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0048285        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0051304        [VIEW IN EMBL-EBI]
GO:0051307        [VIEW IN EMBL-EBI]
GO:0051321        [VIEW IN EMBL-EBI]
GO:0051716        [VIEW IN EMBL-EBI]
GO:0061630        [VIEW IN EMBL-EBI]
GO:0061659        [VIEW IN EMBL-EBI]
GO:0070647        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:0098813        [VIEW IN EMBL-EBI]
GO:0140013        [VIEW IN EMBL-EBI]
GO:0140096        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1902494        [VIEW IN EMBL-EBI]
GO:1903046        [VIEW IN EMBL-EBI]
GO:1990234        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGAGAAAAGGGTTTTATTTTCTTTGCCAATCTCTGCAAAAGTTCTCAACTTTATTAATTTTTCTACACTTTGTAGGTCTGAGGCAGTGCGGGAAGAGCTGCTGTCTGCGGTGGCTAAACCATCTGAGGCCAGACATCAAACATGGAAGCTTCACTGAAGAGGAAGACAGCACTATCTGCAGCCTCTACAACCAGATGGGAAGCCGTTTGAGTCTGCTGAGTTCTGCGGATTTACTCAATTGCAATCATCTTTTCTGCAAGCAATCTCTACCTTCATTGTTAGATTGTTTGCTTATTTTTTACAGCACTTGCACTGTGAAGTCGATGAAATCGGGTTCCTTTTGTCCAGTTTATAAATTCCATATCGGCGTAGAGGCAAGCAAAATGATGTAA
Protein:  
MRKGFYFLCQSLQKFSTLLIFLHFVGLRQCGKSCCLRWLNHLRPDIKHGSFTEEEDSTICSLYNQMGSRLSLLSSADLLNCNHLFCKQSLPSLLDCLLIFYSTCTVKSMKSGSFCPVYKFHIGVEASKMM